Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
COX7A2L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25620225UL
Description
COX7A2L Polyclonal specifically detects COX7A2L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
COX7A2L | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
COX7ARcytochrome c oxidase subunit VII-related protein, COX7a-related protein, COX7RPmitochondrial, cytochrome c oxidase subunit VIIa polypeptide 2 like, Cytochrome c oxidase subunit VIIa-related protein, estrogen receptor binding CpG island, SIG81 | |
Rabbit | |
Affinity Purified | |
RUO | |
9167 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
COX7A2L | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVY | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction