Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPI17 alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP258619
Description
CPI17 alpha Polyclonal specifically detects CPI17 alpha in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
CPI17 alpha | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
17 kDa PKC-potentiated inhibitory protein of PP1, CPI-1717-kDa PKC-potentiated inhibitory protein of PP1, CPI1717-KDa protein, PKC-potentiated inhibitory protein of PP1, PPP1INL, Protein kinase C-potentiated inhibitor protein of 17 kDa, protein phosphatase 1 regulatory subunit 14A, protein phosphatase 1, regulatory (inhibitor) subunit 14A | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
PPP1R14A | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLS | |
100 μL | |
Protein Phosphatase | |
94274 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction