Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPN1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157960
Description
CPN1 Polyclonal specifically detects CPN1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CPN1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
ACBP, Anaphylatoxin inactivator, Arginine carboxypeptidase, Carboxypeptidase N polypeptide 1, carboxypeptidase N polypeptide 1 50 kD, Carboxypeptidase N small subunit, carboxypeptidase N, polypeptide 1, carboxypeptidase N, polypeptide 1, 50kD, CPNcarboxypeptidase N catalytic chain, EC 3.4.17, EC 3.4.17.3, FLJ40792, kininase I, Kininase-1, Lysine carboxypeptidase, Plasma carboxypeptidase B, SCPNcarboxypeptidase N catalytic subunit, Serum carboxypeptidase N | |
Rabbit | |
Affinity purified | |
RUO | |
1369 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
P15169 | |
CPN1 | |
Synthetic peptides corresponding to CPN1(carboxypeptidase N, polypeptide 1) The peptide sequence was selected from the middle region of CPN1. Peptide sequence FQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Chicken: 92%; Zebrafish: 84%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction