Novus Biologicals™ CPSF1 Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CPSF1. Source: E.coli Amino Acid Sequence: PHWLLVTGRGALRLHPMAIDGPVDSFAPFHNVNCPRGFLYFNRQGELRISVLPAYLSYDAPWPVRKIPLRCTAHYVAYHVESKVYAVATSTNTPCARIPRMTGEEKEFETIERDERYIHPQQEAFSIQLISPVSWEAIPNARIELQEWE The CPSF1 Recombinant Protein Antigen is derived from E. coli. The CPSF1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 29894
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: CPSF1 Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: cleavage and polyadenylation specific factor 1, 160kD subunit, cleavage and polyadenylation specific factor 1, 160kDa, Cleavage and polyadenylation specificity factor 160 kDa subunit, cleavage and polyadenylation specificity factor subunit 1, CPSF 160 kDa
• Gene Symbol: CPSF1
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52849. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only.