CPSF4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157114

Catalog No. NBP157114

Description

CPSF4 Polyclonal specifically detects CPSF4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CPSF4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: CPSF4
• Immunogen: Synthetic peptides corresponding to CPSF4(cleavage and polyadenylation specific factor 4, 30kDa) The peptide sequence was selected from the C terminal of CPSF4. Peptide sequence SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK.
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 10898
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: 30kD, cleavage and polyadenylation specific factor 4, 30kD subunit, cleavage and polyadenylation specific factor 4, 30kDa, CPSF 30 kDa subunit, Neb-1, No arches homolog, no arches-like zinc finger protein, NS1 effector domain-binding protein 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: 4.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only