Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPSF6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen CPSF6
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157541
View Documents
Novus Biologicals
NBP157541
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

CPSF6 Polyclonal specifically detects CPSF6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

CPSF6
Polyclonal
Purified
RUO
CFIM, CFIm68, CFIM68CPSF 68 kDa subunit, CFIMcleavage and polyadenylation specific factor 6, 68kD subunit, cleavage and polyadenylation specific factor 6, 68kDa, Cleavage and polyadenylation specificity factor 68 kDa subunit, cleavage and polyadenylation specificity factor subunit 6, HPBRII-4, HPBRII-7, pre-mRNA cleavage factor I, 68kD subunit, pre-mRNA cleavage factor Im (68kD), Pre-mRNA cleavage factor Im 68 kDa subunit, Protein HPBRII-4/7
CPSF6
IgG
Protein A purified
This product is specific to Subunit or Isoform: 6.
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
11052
Synthetic peptides corresponding to CPSF6 (cleavage and polyadenylation specific factor 6, 68kDa) The peptide sequence was selected from the middle region of CPSF6. Peptide sequence PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit