Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB159576100

CPT1B Antibody, Novus Biologicals™
SDP

Catalog No. NB159576100 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB159576100 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB159576100 Supplier Novus Biologicals Supplier No. NBP159576100UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 4 publications

CPT1B Polyclonal specifically detects CPT1B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CPT1B
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml, Immunohistochemistry 1:300
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q92523
Gene Alias carnitine O-palmitoyltransferase 1, muscle isoform, carnitine O-palmitoyltransferase I, mitochondrial muscle isoform, Carnitine O-palmitoyltransferase I, muscle isoform, Carnitine palmitoyltransferase 1B, carnitine palmitoyltransferase 1B (muscle), Carnitine palmitoyltransferase I-like protein, CPT I, CPT1M, CPT1-MMCCPT1, CPTI, CPTI-M, EC 2.3.1, EC 2.3.1.21, FLJ55729, FLJ58750, KIAA1670, MCPT1, M-CPT1
Gene Symbols CPT1B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CPT1B(carnitine palmitoyltransferase 1B (muscle)) The peptide sequence was selected from the middle region of CPT1B. Peptide sequence DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA.
Molecular Weight of Antigen 88 kDa
Purification Method Affinity Purified
Quantity 100 μL
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 1375
Target Species Human, Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.