CPT1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications

Supplier:  Novus Biologicals NBP159576100UL

Catalog No. NB159576100

Description

CPT1B Polyclonal specifically detects CPT1B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CPT1B
• Classification: Polyclonal
• Dilution: Western Blot 0.2-1 ug/ml, Immunohistochemistry 1:300
• Gene Accession No.: Q92523
• Gene Symbols: CPT1B
• Immunogen: Synthetic peptides corresponding to CPT1B(carnitine palmitoyltransferase 1B (muscle)) The peptide sequence was selected from the middle region of CPT1B. Peptide sequence DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA.
• Purification Method: Affinity Purified
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 1375
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: carnitine O-palmitoyltransferase 1, muscle isoform, carnitine O-palmitoyltransferase I, mitochondrial muscle isoform, Carnitine O-palmitoyltransferase I, muscle isoform, Carnitine palmitoyltransferase 1B, carnitine palmitoyltransferase 1B (muscle), Carnitine palmitoyltransferase I-like protein, CPT I, CPT1M, CPT1-MMCCPT1, CPTI, CPTI-M, EC 2.3.1, EC 2.3.1.21, FLJ55729, FLJ58750, KIAA1670, MCPT1, M-CPT1
• Host Species: Rabbit
• Molecular Weight of Antigen: 88 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Isotype: IgG