Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579065

Invitrogen™ CPT1B Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579065
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579065 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579065 Supplier Invitrogen™ Supplier No. PA579065
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat heart tissue, rat skeletal muscle tissue, mouse heart tissue, mouse skeletal muscle tissue. IHC: Mouse Skeletal Muscle tissue, Rat Cardiac Muscle tissue IHC-F: mouse cardiac muscle tissue, rat cardiac muscle tissue.

The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CPT1B
Applications Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene CPT1B
Gene Accession No. Q63704, Q924X2, Q92523
Gene Alias carnitine O-palmitoyltransferase 1, muscle isoform; carnitine O-palmitoyltransferase 1, muscle isoform; synaptonemal complex central element protein 3; carnitine O-palmitoyltransferase 1B; carnitine O-palmitoyltransferase I, mitochondrial muscle isoform; carnitine O-palmitoyltransferase I, muscle isoform; Carnitine palmitoyltransferase 1 beta, muscle isoform; Carnitine palmitoyltransferase 1, muscle; carnitine palmitoyltransferase 1A like; carnitine palmitoyltransferase 1B; carnitine palmitoyltransferase 1B (muscle); carnitine palmitoyltransferase 1B isoform a; carnitine palmitoyltransferase 1b, muscle; carnitine palmitoyltransferase I; carnitine palmitoyltransferase Ibeta 1; carnitine palmitoyltransferase Ibeta 2; carnitine palmitoyltransferase Ibeta 3; carnitine palmitoyltransferase I-like protein; CPT I; Cpt1; cpt1al; CPT1B; CPT1M; Cpt1-m; CPTI; CPTIB; CPT-IB; CPT-Ibeta 1; CPT-Ibeta 3; CPTI-M; EC 2.3.1.21; FLJ55729; FLJ58750; hypothetical protein LOC449677; KIAA1670; LOW QUALITY PROTEIN: carnitine O-palmitoyltransferase 1, muscle isoform; MCCPT1; MCPT1; M-CPT1; M-cpti; muscle-type carnitine palmitoyltransferase I; zgc:103709
Gene Symbols CPT1B
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human CPT1B (197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 12895, 1375, 25756
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.