Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA5143856

Invitrogen™ CRB1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA5143856
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA5143856 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA5143856 Supplier Invitrogen™ Supplier No. PA5143856
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Positive Control - WB: human HEK293 whole cell, human U-87MG whole cell. IHC: mouse testis tissue, human testis cancer tissue, rat testis tissue, human glioma tissue. Flow: U87 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

CRB1 (Crumbs homolog 1) plays a role in photoreceptor morphogenesis in the retina. It may maintain cell polarization and adhesion. CRB1 is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. The first identified human homolog, CRB1, is expressed in retina and some parts of the brain, leaving room for another homolog to function in epithelial tissues. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CRB1
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene CRB1
Gene Accession No. P82279, Q8VHS2
Gene Alias CRB1; crumbs 1, cell polarity complex component; crumbs family member 1, photoreceptor morphogenesis associated; Crumbs homolog 1; LCA8; Protein crumbs homolog 1; RP12
Gene Symbols CRB1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human CRB1 (FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 170788, 23418, 304825
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.