Invitrogen™ CRB1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA5143856

Catalog No. PIPA5143856

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Positive Control - WB: human HEK293 whole cell, human U-87MG whole cell. IHC: mouse testis tissue, human testis cancer tissue, rat testis tissue, human glioma tissue. Flow: U87 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

CRB1 (Crumbs homolog 1) plays a role in photoreceptor morphogenesis in the retina. It may maintain cell polarization and adhesion. CRB1 is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. The first identified human homolog, CRB1, is expressed in retina and some parts of the brain, leaving room for another homolog to function in epithelial tissues. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis.

Specifications

• Antigen: CRB1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: CRB1
• Gene Alias: CRB1; crumbs 1, cell polarity complex component; crumbs family member 1, photoreceptor morphogenesis associated; Crumbs homolog 1; LCA8; Protein crumbs homolog 1; RP12
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 170788, 23418, 304825
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P82279, Q8VHS2
• Gene Symbols: CRB1
• Immunogen: A synthetic peptide corresponding to a sequence of human CRB1 (FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG