Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Creatine Kinase, Muscle/CKMM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Creatine Kinase, Muscle/CKMM |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Creatine Kinase, Muscle/CKMM Polyclonal specifically detects Creatine Kinase, Muscle/CKMM in Human, Mouse samples. It is validated for Western Blot.Specifications
Creatine Kinase, Muscle/CKMM | |
Polyclonal | |
Rabbit | |
P06732 | |
CKM | |
IgG | |
43 kDa |
Western Blot | |
Unconjugated | |
RUO | |
1158 | |
Synthetic peptides corresponding to CKM(creatine kinase, muscle) The peptide sequence was selected from the middle region of CKM. Peptide sequence GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title