CREB3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25830725UL

Catalog No. NB393517

Description

CREB3 Polyclonal specifically detects CREB3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CREB3
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: basic leucine zipper protein, cAMP responsive element binding protein 3, cAMP responsive element binding protein 3 (luman), cAMP-responsive element-binding protein 3, CREB-3, cyclic AMP response element (CRE)-binding protein/activating transcriptionfactor 1, cyclic AMP-responsive element-binding protein 3, LUMAN, LZIPMGC15333, MGC19782, Transcription factor LZIP-alpha
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10488
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CREB3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTS
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only