Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CREG2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$208.00 - $487.50
Specifications
| Antigen | CREG2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17050920
|
Novus Biologicals
NBP17050920UL |
20 μL |
Each for $208.00
|
|
|||||
|
NBP170509
|
Novus Biologicals
NBP170509 |
100 μL |
Each for $487.50
|
|
|||||
Description
CREG2 Polyclonal specifically detects CREG2 in Human samples. It is validated for Western Blot.Specifications
| CREG2 | |
| Polyclonal | |
| Rabbit | |
| cellular repressor of E1A-stimulated genes 2 | |
| CREG2 | |
| IgG | |
| 32 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 200407 | |
| Synthetic peptides corresponding to CREG2(cellular repressor of E1A-stimulated genes 2) The peptide sequence was selected from the N terminal of CREG2. Peptide sequence VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAH. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title