Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CRHBP Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31769725UL
This item is not returnable.
View return policy
Description
CRHBP Polyclonal antibody specifically detects CRHBP in Human samples. It is validated for Western BlotSpecifications
CRHBP | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml | |
corticotropin releasing hormone binding protein, corticotropin-releasing factor-binding protein, Corticotropin-releasing hormone-binding protein, CRFBPcorticotropin releasing hormone-binding protein, CRF-BPCRF-binding protein, CRH-BP | |
This antibody was developed against Recombinant Protein corresponding to amino acids: TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE | |
25 μg | |
Signal Transduction | |
1393 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction