Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CRHBP Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$343.50 - $573.00

Specifications

Antigen	CRHBP
Dilution	Western Blot 0.04-0.4 ug/ml
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB159425 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP31769725UL	25 μg	Each for $343.50	Only null left	Sign In or Register to check your price. Add to Cart

NB159424 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP317697100UL	100 μg	Each for $573.00	Only null left	Sign In or Register to check your price. Add to Cart

Description

CRHBP Polyclonal antibody specifically detects CRHBP in Human samples. It is validated for Western Blot

Specifications

Antigen	CRHBP
Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Signal Transduction
Formulation	PBS, pH 7.2, 40% glycerol
Gene ID (Entrez)	1393
Isotype	IgG
Purification Method	Affinity purified

Dilution	Western Blot 0.04-0.4 ug/ml
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	corticotropin releasing hormone binding protein, corticotropin-releasing factor-binding protein, Corticotropin-releasing hormone-binding protein, CRFBPcorticotropin releasing hormone-binding protein, CRF-BPCRF-binding protein, CRH-BP
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CRHBP Rabbit anti-Human, Polyclonal, Novus Biologicals™

Specifications

Description

Specifications

Documents