CRISP-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP26260125UL

Catalog No. NB393078

Description

CRISP-1 Polyclonal antibody specifically detects CRISP-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: CRISP-1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: Acidic epididymal glycoprotein homolog, acidic epididymal glycoprotein-like 1, AEG-related protein, ARPAEG-like protein, CRISP-1AEGL1HSCRISP1D, cysteine-rich secretory protein 1, cysteine-rich secretory protein-1 delta, HSCRISP1G, HUMARP
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRY
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 167
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG