CRISPLD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169620

Catalog No. NBP169620

Description

CRISPLD2 Polyclonal specifically detects CRISPLD2 in Human samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

• Antigen: CRISPLD2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CRISP11, CRISP-11, Cysteine-rich secretory protein 11, cysteine-rich secretory protein LCCL domain containing 2, cysteine-rich secretory protein LCCL domain-containing 2, DKFZP434B044, LCCL domain containing cysteine-rich secretory protein 2, LCCL domain-containing cysteine-rich secretory protein 2, LCRISP2, MGC74865
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Mouse: 86%.
• Target Species: Human, Mouse, Rat
• Isotype: IgG

• Applications: Western Blot, Immunoprecipitation
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunoprecipitation
• Gene Accession No.: Q9H0B8
• Gene Symbols: CRISPLD2
• Immunogen: Synthetic peptides corresponding to CRISPLD2(cysteine-rich secretory protein LCCL domain containing 2) The peptide sequence was selected from the N terminal of CRISPLD2. Peptide sequence MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83716
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only