CRLR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159073

Catalog No. NBP159073

Description

CRLR Polyclonal specifically detects CRLR in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CALCRL
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: calcitonin gene-related peptide type 1 receptor, calcitonin receptor-like, CGRP type 1 receptor, CGRPRCRLRCalcitonin receptor-like receptor
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Chicken: 92%; Goat: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q16602
• Gene Symbols: CALCRL
• Immunogen: Synthetic peptides corresponding to CALCRL(calcitonin receptor-like) The peptide sequence was selected from the N terminal of CALCRL. Peptide sequence DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL.
• Quantity: 100 μL
• Research Discipline: Cancer, GPCR
• Gene ID (Entrez): 10203
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only