Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CRM1 Antibody [CoraFluorÖ 1], Novus Biologicals Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP335072CL1
Description
CRM1 Polyclonal antibody specifically detects CRM1 in Human,Mouse samples. It is validated for ELISA,Western BlotSpecifications
CRM1 | |
Polyclonal | |
PBS | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human, Mouse | |
Antibody | |
IgG |
ELISA, Western Blot | |
CoraFluor 1 | |
Chromosome region maintenance 1 protein homolog, DKFZp686B1823, emb, exp1, exportin 1 (CRM1 homolog, yeast), exportin 1 (CRM1, yeast, homolog), exportin-1, Exportin-1 (required for chromosome region maintenance), yeast, homolog | |
A synthetic peptide corresponding to a sequence within amino acids 964-1064 of human CRM1 (NP_003391.1).,, Sequence:, PGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHE | |
0.1 mL | |
Core ESC Like Genes, Stem Cell Markers | |
7514 | |
Store at 4°C in the dark. Do not freeze. | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction