CRMP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP184985

Catalog No. NBP184985

Description

CRMP1 Polyclonal specifically detects CRMP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CRMP1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Alias: collapsin response mediator protein 1DRP1, CRMP-1, dihydropyrimidinase-like 1, dihydropyrimidinase-related protein 1, DPYSL1DRP-1dihydropyrimidinase related protein-1, ULIP3, ULIP-3, Unc-33-like phosphoprotein 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CRMP1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVK
• Quantity: 0.1 mL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 1400
• Target Species: Human
• Isotype: IgG

For Research Use Only