Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ CRY1 Recombinant Protein

Specifications

Accession Number	AAH30519
For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez)	1407
Molecular Weight (g/mol)	90.2

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
89-010-002 View Documents View Product Certificates	Abnova™ H00001407P0110	10 ug	Item Discontinued This item has been discontinued by the supplier. Please Sign In to view product availability in your area.		N/A

89-010-003 View Documents View Product Certificates	Abnova™ H00001407P0125	25 ug	Item Discontinued This item has been discontinued by the supplier. Please Sign In to view product availability in your area.		N/A

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH30519
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	90.2
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	CRY1
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	1407
Name	CRY1 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN
Gene Alias	PHLL1
Gene Symbol	CRY1
Species	Wheat Germ (in vitro)
Protein Tag	GST

Spot an opportunity for improvement?

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Abnova™ CRY1 Recombinant Protein

Specifications

Description

Specifications

Documents