Invitrogen™ CRY2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579073

Catalog No. PIPA579073

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Testis Tissue, Rat Brain Tissue, Mouse Brain Tissue, 22RV1 whole cell. IHC: rat liver tissue, mouse kidney tissue.

Various biochemical, physiological and behavioral processes display circadian rhythms controlled by an internal biological clock. The central gears driving this clock appear to be composed of an autoregulatory transcription/post translation-based feedback loop. Cryptochrome 1 (CRY1) and 2 (CRY2) are DNA-binding flavoproteins that bear some homology to blue-light receptors and photolyases. In Drosophila, CRY is a photoreceptor for the circadian clock where it binds to the clock component TIM in a light-dependent fashion and blocks its function. Mammalian CRY1 and CRY2 function via light-independent interactions with circadian genes CLOCK and BMAL1, as well as with PER1, PER2, and TIM. They seem to act as light-independent components of the circadian clock and likely regulate Per1 transcriptional cycling via interactions with both the activator and its feedback inhibitors. Mutant mice not expressing the Cry1 or Cry2 protein display accelerated and delayed periodicity of locomotor activity, respectively. It appears that the combination of both proteins working together is essential to synchronize the organism to circadian phases. A critical balance between Cry1 and Cry2 is required for proper clock function; in complete darkness, double-mutant mice present with instantaneous arrhythmicity, indicating the absence of an internal circadian clock.

Specifications

• Antigen: CRY2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: CRY2
• Gene Alias: AV006279; CRY2; cryptochrome 2 (photolyase-like); cryptochrome circadian clock 2; cryptochrome-2; D130054K12Rik; growth-inhibiting protein 37; HCRY2; Kiaa0658; PHLL2
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 12953, 1408, 170917
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q49AN0, Q923I8, Q9R194
• Gene Symbols: CRY2
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CRY2 (171-200aa RFQAIISRMELPKKPVGLVTSQQMESCRAE).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov