Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CS Citrate Synthase Antibody (CL2545), Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP23677125UL
Description
CS Citrate Synthase Monoclonal specifically detects CS Citrate Synthase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| CS Citrate Synthase | |
| Monoclonal | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| citrate synthase, citrate synthase, mitochondrial, EC 2.3.3, EC 2.3.3.1 | |
| Mouse | |
| Protein A purified | |
| RUO | |
| 1431 | |
| Protein A purified | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. | |
| IgG1 |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
| CL2545 | |
| Western Blot 1 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| O75390 | |
| CS | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWL | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction