Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CS Citrate Synthase Antibody (CL2545), Novus Biologicals™

Mouse Monoclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | CS Citrate Synthase |
|---|---|
| Clone | CL2545 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
Description
CS Citrate Synthase Monoclonal specifically detects CS Citrate Synthase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| CS Citrate Synthase | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| Mouse | |
| Human | |
| O75390 | |
| 1431 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWL | |
| Primary | |
| Protein A purified |
| CL2545 | |
| Monoclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| citrate synthase, citrate synthase, mitochondrial, EC 2.3.3, EC 2.3.3.1 | |
| CS | |
| IgG1 | |
| Protein A purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title