Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CS Citrate Synthase Antibody (CL2553), Novus Biologicals™
SDP

Catalog No. NB404705 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB404705 25 μL
NBP236773 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB404705 Supplier Novus Biologicals Supplier No. NBP23677325UL
Only null left
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

CS Citrate Synthase Monoclonal specifically detects CS Citrate Synthase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen CS Citrate Synthase
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Classification Monoclonal
Clone CL2553
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. O75390
Gene Alias citrate synthase, citrate synthase, mitochondrial, EC 2.3.3, EC 2.3.3.1
Gene Symbols CS
Host Species Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWL
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1431
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reconstitution Protein A purified
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.