CSB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP303839

Catalog No. NB095655

Description

CSB Polyclonal specifically detects CSB in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CSB
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin
• Gene Alias: ARMD5, ATP-dependent helicase ERCC6, CKN2, Cockayne syndrome group B protein, Cockayne syndrome protein CSB, COFS, COFS1, CSBCockayne syndrome B protein, DNA excision repair protein ERCC-6, EC 3.6.1, EC 3.6.4.-, excision repair cross-complementing rodent repair deficiency, complementationgroup 6, RAD26, Rad26 homolog
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700-800 of human CSB (NP_000115.1). LPVFMEQFSVPITMGGYSNASPVQVKTAYKCACVLRDTINPYLLRRMKSDVKMSLSLPDKNEQVLFCRLTDEQHKVYQNFVDSKEVYRILNGEMQIFSGLI
• Quantity: 100 μL
• Research Discipline: Cancer, DNA Repair, Nucleotide Excision Repair
• Gene ID (Entrez): 2074
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified