CSE1L/CAS/Exportin-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23838425UL

Catalog No. NB396854

Description

CSE1L/CAS/Exportin-2 Polyclonal specifically detects CSE1L/CAS/Exportin-2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CSE1L/CAS/Exportin-2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: P55060
• Gene Symbols: CSE1L
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HGITQANELVNLTEFFVNHILPDLKSANVNEFPVLKADGIKYIMIFRNQVPKEHLLVSIPLLINHLQAESIVVHTYAAHALERLFTMRGPNNATLF
• Quantity: 25 μL
• Research Discipline: Apoptosis, Cancer, Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 1434
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CASMGC117283, Cellular apoptosis susceptibility protein, chromosome segregation 1 (yeast homolog)-like, Chromosome segregation 1-like protein, CSE1, CSE1 chromosome segregation 1-like (yeast), CSE1L, Exp2, exportin-2, Importin-alpha re-exporter, MGC130037, XPO2MGC130036
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.