Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CSH2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CSH2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CSH2 Polyclonal specifically detects CSH2 in Human samples. It is validated for Western Blot.Specifications
CSH2 | |
Polyclonal | |
Rabbit | |
B1A4H9 | |
1443 | |
Synthetic peptides corresponding to CSH2 (chorionic somatomammotropin hormone 2) The peptide sequence was selected from the middle region of CSH2. Peptide sequence LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
chorionic somatomammotropin B, chorionic somatomammotropin hormone 2, CS-2, CSBChoriomammotropin, hCS-B, Lactogen, PL, Placental lactogen | |
CSH2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title