Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CSN3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CSN3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CSN3 Polyclonal specifically detects CSN3 in Human samples. It is validated for Western Blot.Specifications
CSN3 | |
Polyclonal | |
Rabbit | |
Human | |
casein kappa, casein, kappa, CASK, CSN10kappa-casein, CSNK, KCA | |
CSN3 | |
IgG | |
20 kDa |
Western Blot | |
Unconjugated | |
RUO | |
P07498 | |
1448 | |
Synthetic peptides corresponding to CSN3 (casein kappa) The peptide sequence was selected from the N terminal of CSN3. Peptide sequence MKSFLLVVNALALTLPFLAVEVQNQKQPACHENDERPFYQKTAPYVPMYY. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title