Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CSRP2BP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | CSRP2BP |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CSRP2BP Polyclonal specifically detects CSRP2BP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
CSRP2BP | |
Polyclonal | |
Rabbit | |
Human | |
57325 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IYGAKEGGISRLPAGQATYRTTCQDFRILDRYQTSLPSRKGFRHQTTKFLYRLVGSEDMAVDQSIVSPYTSRILKPYIRRDYETKPPKLQLLSQIRSHLH | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
ADA2A-containing complex subunit 2, ATAC component 2 homolog, ATAC2CRP2BPKAT14, CRP2 binding partner, CRP2 binding protein, CRP2-binding partner, CSRP2 binding protein, CSRP2-binding protein, cysteine rich protein 2 binding protein, cysteine-rich protein 2-binding protein, dJ717M23.1, MGC15388, PRO1194 | |
KAT14 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title