Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CTIF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | CTIF |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15742320
![]() |
Novus Biologicals
NBP15742320UL |
20 μL |
Each for $206.00
|
|
|||||
NBP157423
![]() |
Novus Biologicals
NBP157423 |
100 μL |
Each for $487.50
|
|
|||||
Description
CTIF Polyclonal specifically detects CTIF in Human samples. It is validated for Western Blot.Specifications
CTIF | |
Polyclonal | |
Rabbit | |
O43310 | |
9811 | |
Synthetic peptides corresponding to KIAA0427(KIAA0427) The peptide sequence was selected from the N terminal of KIAA0427. Peptide sequence QVQGLLADKTEGDGESERTQSHISQWTADCSEPLDSSCSFSRGRAPPQQN. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CBP80/20-dependent translation initiation factor, KIAA0427Gm672 | |
CTIF | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title