Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CTL1/SLC44A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317824100UL
This item is not returnable.
View return policy
Description
CTL1/SLC44A1 Polyclonal antibody specifically detects CTL1/SLC44A1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
CTL1/SLC44A1 | |
Polyclonal | |
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
CD92 antigen, CDw92, CDW92 antigen, CDW92choline transporter-like protein 1, CHTL1, CTL1CD92RP11-287A8.1, Solute carrier family 44 member 1, solute carrier family 44, member 1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: LFLCLAIDTKYNDGSPGREFYMDKVLMEFVENSRKAMKEAGKGGVADSRELKPMASGASS | |
100 μg | |
Cancer, CD Markers, Endocrinology, Immunology, Signal Transduction | |
23446 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction