Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cullin 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310871100UL
Description
Cullin 2 Polyclonal specifically detects Cullin 2 in Human samples. It is validated for Western Blot.Specifications
Cullin 2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
CUL-2, cullin 2, cullin-2, MGC131970 | |
The immunogen is a synthetic peptide directed towards the C terminal region of human Cullin 2 (NP_003582). Peptide sequence HNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA | |
100 μg | |
Apoptosis, Cancer, Cell Cycle and Replication, DNA Repair, DNA replication Transcription Translation and Splicing | |
8453 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction