Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CUTC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CUTC |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CUTC Polyclonal specifically detects CUTC in Human samples. It is validated for Western Blot.Specifications
CUTC | |
Polyclonal | |
Rabbit | |
Q9NTM9 | |
51076 | |
Synthetic peptides corresponding to CUTC(cutC copper transporter homolog (E. coli)) The peptide sequence was selected from the middle region of CUTC. Peptide sequence LEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARST. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CGI-32, copper homeostasis protein cutC homolog, cutC copper transporter homolog (E. coli), RP11-483F11.3 | |
CUTC | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title