Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CWC22 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169211
Description
CWC22 Polyclonal specifically detects CWC22 in Human samples. It is validated for Western Blot.Specifications
CWC22 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
CWC22 spliceosome-associated protein homolog (S. cerevisiae), EIF4GL, fSAPbpre-mRNA-splicing factor CWC22 homolog, KIAA1604NCMfunctional spliceosome-associated protein b, Nucampholin homolog | |
Rabbit | |
105 kDa | |
100 μL | |
Primary | |
Canine: 86%; Bovine: 86%; Guinea pig: 86%; Rat: 83%; Mouse: 83%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9HCG8 | |
CWC22 | |
Synthetic peptides corresponding to KIAA1604 (CWC22 spliceosome-associated protein homolog (S. cerevisiae)) The peptide sequence was selected from the C terminal of KIAA1604. Peptide sequence RSKSKEMNRKHSGSRSDEDRYQNGAERRWEKSSRYSEQSRESKKNQDRRR The peptide sequence for this immunogen was taken from within the described region. | |
Affinity purified | |
RUO | |
57703 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction