Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CYB5D1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CYB5D1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CYB5D1 Polyclonal specifically detects CYB5D1 in Human samples. It is validated for Western Blot.Specifications
CYB5D1 | |
Polyclonal | |
Rabbit | |
Q6P9G0 | |
124637 | |
Synthetic peptides corresponding to CYB5D1(cytochrome b5 domain containing 1) The peptide sequence was selected from the middle region of CYB5D1. Peptide sequence KYEGKNLNMDFTLEENGIRDEEEEFDYLSMDGTLHTPAILLYFNDDLTEL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
cytochrome b5 domain containing 1, cytochrome b5 domain-containing protein 1, FLJ32499 | |
CYB5D1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title