Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CYC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154770
Description
CYC1 Polyclonal specifically detects CYC1 in Human samples. It is validated for Western Blot.Specifications
CYC1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Complex III subunit 4, Complex III subunit IV, cytochrome c1, heme protein, mitochondrial, cytochrome c-1Cytochrome b-c1 complex subunit 4, Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit, UQCR4 | |
Rabbit | |
35 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
P08574 | |
CYC1 | |
Synthetic peptides corresponding to CYC1(cytochrome c-1) The peptide sequence was selected from the middle region of CYC1. Peptide sequence RWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPP. | |
Affinity purified | |
RUO | |
1537 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction