Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cyclin L2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $610.00
Specifications
Antigen | Cyclin L2 |
---|---|
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Cyclin L2 Polyclonal specifically detects Cyclin L2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Cyclin L2 | |
Polyclonal | |
Rabbit | |
Human | |
ania-6b, CCNM, cyclin L2, cyclin M, cyclin-L2, DKFZp761A1210, DKFZp762O195, HCLA-ISO, HLA-ISO, Paneth cell-enhanced expression protein, PCEE, SB138 | |
CCNL2 | |
IgG | |
Affinity Purified |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
81669 | |
This antibody was developed against a recombinant protein corresponding to amino acids: DRLYSGVLITLENCLLPDDKLRFTPSMSSGLDTDTETDLRVVGCEL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title