Invitrogen™ Cyclin T1 Monoclonal Antibody (3B7)

Catalog No.	Quantity
PIMA549233	100 μg

Catalog No. PIMA549233 Supplier Invitrogen™ Supplier No. MA549233

Description

Mouse Monoclonal Antibody

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is different from the related mouse sequence by one amino acid. Positive Control - WB: human Jurkat whole cell, human Hela whole cell, human SW620 tissue, monkey COS-7 whole cell. Flow: U20S cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.

Specifications

• Antigen: Cyclin T1
• Applications: Flow Cytometry, Western Blot
• Classification: Monoclonal
• Clone: 3B7
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and no preservative
• Gene: Ccnt1
• Gene Accession No.: O60563
• Gene Alias: 2810478G24Rik; AI115585; CCNT; CCNT1; CDK9-associated C-type protein; cyclin C-related protein; cyclin T1; cyclin T1b; cyclin-T; cyclin-T1; CycT1; HIVE1; human immunodeficiency virus type 1 (HIV-1) expression (elevated) 1
• Gene Symbols: Ccnt1
• Host Species: Mouse
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Cyclin T1 (375-410aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM).
• Purification Method: Antigen affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 904
• Target Species: Human, Monkey
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG2b