Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Cyclin T1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Cyclin T1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. p-7248705 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB169553 25 μg
NB169552 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB169553 Supplier Novus Biologicals Supplier No. NBP31723825UL
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Cyclin T1 Polyclonal antibody specifically detects Cyclin T1 in Human samples. It is validated for Western Blot, Immunofluorescence

Specifications

Antigen Cyclin T1
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias CCNT, CCNT1, CCNTcyclin-T, CDK9-associated C-type protein, cyclin C-related protein, cyclin T1, cyclin T1b, Cyclin-T, cyclin-T1, CYCT1, HIVE1, human immunodeficiency virus type 1 (HIV-1) expression (elevated) 1, Human immunodeficiency virus-1 expression, subunit of positive elongation transcription factor b
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: MEANVKSQYAYAAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEIKMRIKVHAAADKHNSV
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 904
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.