Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cyclophilin B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | Cyclophilin B |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP162356
![]() |
Novus Biologicals
NBP162356 |
100 μL |
Each for $480.74
|
|
|||||
NBP16235620
![]() |
Novus Biologicals
NBP16235620UL |
20 μL | Item Discontinued This item has been discontinued by the supplier. Please Sign In to view product availability in your area. | N/A | |||||
Description
Cyclophilin B Polyclonal specifically detects Cyclophilin B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Cyclophilin B | |
| Polyclonal | |
| Purified | |
| RUO | |
| Cyclophilin B, cyclophilin-like protein, CYPBEC 5.2.1.8, CYP-S1, MGC2224, OI9MGC14109, peptidyl-prolyl cis-trans isomerase B, peptidylprolyl isomerase B (cyclophilin B), PPIase B, Rotamase B, S-cyclophilin, SCYLP | |
| PPIB | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| A8K534 | |
| 5479 | |
| Synthetic peptides corresponding to PPIB(peptidylprolyl isomerase B (cyclophilin B)) The peptide sequence was selected from the C terminal of PPIB. Peptide sequence VVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE. | |
| Primary | |
| 24 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title