Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cylicin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Cylicin 1 |
---|---|
Dilution | Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Cylicin 1 Polyclonal specifically detects Cylicin 1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Cylicin 1 | |
Polyclonal | |
Rabbit | |
Human | |
CYCL1, CYL, CYL1, cylicin 1, cylicin I, cylicin, basic protein of sperm head cytoskeleton 1, cylicin-1, multiple-band polypeptide I | |
CYLC1 | |
IgG | |
Affinity Purified |
Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
1538 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KKDSKKDDKKKDAKKNAESTEMESDLELKKDKKHSKEKKGSKKDIKKDARKDTESTDAEFDESSKTGFKTSTKIKGSDTESEESLYKP | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title