Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA595393

Invitrogen™ CYP17A1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595393
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595393 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595393 Supplier Invitrogen™ Supplier No. PA595393
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human SH-SY5Y whole cell, human HepG2 whole cell, human Hela whole cell, human Jurkat whole cell, rat testis tissue. IHC: human testis tissue. Flow: U87 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and 17,20-lyase activities and is a key enzyme in the steroidogenic pathway that produces progestins, mineralocorticoids, glucocorticoids, androgens, and estrogens. Mutations in this gene are associated with isolated steroid-17 alpha-hydroxylase deficiency, 17-alpha-hydroxylase/17,20-lyase deficiency, pseudohermaphroditism, and adrenal hyperplasia.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CYP17A1
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.01mg sodium azide
Gene CYP17A1
Gene Accession No. P05093, P11715
Gene Alias 17a-hydroxylase; 17-alpha-hydroxyprogesterone aldolase; CPT7; Cyp17; Cyp17a1; CYPXVII; cytochrome P450 17A1; cytochrome P450 family 17 subfamily A member 1; cytochrome p450 XVIIA1; cytochrome P450, 17; cytochrome P450, 17a1; cytochrome P450, family 17, subfamily A, polypeptide 1; cytochrome P450, subfamily 17; Cytochrome P450, subfamily XVII; cytochrome P450, subfamily XVII (steroid 17-alpha-hydroxylase), adrenal hyperplasia; Cytochrome P450c17; cytochrome P450-C17; HGNC:2593; P45017alpha; p450c17; P450-C17; S17AH; steroid 17-alpha hydroxylase; steroid 17-alpha-hydroxylase/17,20 lyase; Steroid 17-alpha-monooxygenase
Gene Symbols CYP17A1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human CYP17A1 (383-419aa EFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLN).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1586, 25146
Target Species Human, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.