CYP20A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP231719

Catalog No. NBP231719

Description

CYP20A1 Polyclonal specifically detects CYP20A1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CYP20A1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q6UW02
• Gene Symbols: CYP20A1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EVIRFQKNHGTVWSEIGKGFLDGSLDKNMTRKKQYEDALMQLESVLRNIIKERKGRNFSQHIFIDSLVQGNLNDQQILED
• Quantity: 0.1 mL
• Research Discipline: Cancer, Cardiovascular Biology, Cellular Signaling, metabolism
• Gene ID (Entrez): 57404
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CYP-M, cytochrome P450 20A1, cytochrome P450 monooxygenase, cytochrome P450, family 20, subfamily A, polypeptide 1, EC 1.14, MGC22229
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only