Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CYP27B1 Polyclonal Antibody
CYP27B1 Polyclonal Antibody
Supplier: Thermo Scientific PA579128
Description
CYP27B1 Polyclonal Antibody for Western Blot, IHC (P)

Specifications
CYP27B1 | |
Polyclonal | |
Unconjugated | |
CYP27B1 | |
1alpha(OH)ase; 25 hydroxyvitamin D3-1-alpha hydroxylase; 25(OH)D 1alpha-hydroxylase; 25-hydroxyvitamin D(3) 1-alpha-hydroxylase; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial precursor (25-OHD-1 alpha-hydroxylase) (25-hydroxyvitamin D3 1-alpha-hydroxylase) (VD3 1A hydroxylase) (P450C1 alpha) (P450VD1-alpha); 25-hydroxyvitamin D3 1alpha-hydroxylase; 25-OHD-1 alpha-hydroxylase; Calcidiol 1-monooxygenase; Cp2b; cy; Cyp1; CYP1alpha; Cyp27b; Cyp27b1; Cyp40; cytochrome p450 27B1; cytochrome P450 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450 family 27 subfamily B member 1; cytochrome P450 subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase) polypeptide 1; cytochrome P450 subfamily XXVIIB polypeptide 1; cytochrome P450, 27b1; cytochrome P450, 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450, family 27, subfamily B, polypeptide 1; cytochrome P450, subfamily 27b, polypeptide 1; cytochrome P450C1 alpha; Cytochrome P450VD1-alpha; P450c1; P450C1 alpha; P450VD1alpha; P450VD1-alpha; Pddr; VD3 1A hydroxylase; Vdd1; Vddr; VDDRI; VDR | |
Rabbit | |
Antigen Affinity Chromatography | |
RUO | |
114700, 13115, 1594 | |
-20°C | |
Lyophilized |
Immunohistochemistry (Paraffin), Western Blot | |
500 μg/mL | |
PBS with 5mg BSA and 0.05mg sodium azide | |
O15528, O35084, O35132 | |
CYP27B1 | |
A synthetic peptide corresponding to a sequence at the C-terminus of human CYP27B1 (475-508aa HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR). | |
100 μg | |
Primary | |
Human, Mouse, Rat | |
Antibody | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction