CYP2A7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169675

Catalog No. NBP169675

Description

CYP2A7 Polyclonal specifically detects CYP2A7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CYP2A7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CPA7, CPAD, CYP2A, CYPIIA7, cytochrome P450 2A7, Cytochrome P450 IIA4, cytochrome P450, family 2, subfamily A, polypeptide 7, cytochrome P450, subfamily IIA (phenobarbital-inducible), polypeptide 7, EC 1.14.14.1, P450-IIA4
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P20853
• Gene Symbols: CYP2A7
• Immunogen: Synthetic peptides corresponding to CYP2A7 (cytochrome P450, family 2, subfamily A, polypeptide 7) The peptide sequence was selected from the N terminal of CYP2A7. Peptide sequence MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLN.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1549
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG

For Research Use Only