Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ CYP2D6 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579129
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579129 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579129 Supplier Invitrogen™ Supplier No. PA579129
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat liver tissue, mouse liver tissue. IHC: rat intestine tissue, mouse liver tissue, human liver cancer tissue, mouse intestine tissue.

Cytochrome p450 2D6 (CYP2D6) is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CYP2D6
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene CYP2D6
Gene Accession No. P10635, P12938, Q64680
Gene Alias AI303445; Cholesterol 25-hydroxylase; CPD6; CYP2D; Cyp2d10; Cyp2d-10; Cyp2d13; Cyp2d18; Cyp2d-18; Cyp2d22; Cyp2d3; Cyp2d-3; Cyp2d4; Cyp2d-4; Cyp2d4v1; Cyp2d4v2; Cyp2d6; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2; CYP2DL1; CYPIID10; CYPIID18; CYPIID3; CYPIID4; CYPIID6; Cytochrome P450 2D10; cytochrome P450 2d18; Cytochrome P450 2D-29; Cytochrome P450 2D3; cytochrome P450 2D-35; cytochrome P450 2D4; Cytochrome P450 2D6; cytochrome P450 family 2 subfamily D member 6; cytochrome P450, 2d10; cytochrome P450, family 2, subfamily d, polypeptide 10; cytochrome P450, family 2, subfamily d, polypeptide 13; cytochrome P450, family 2, subfamily d, polypeptide 22; cytochrome P450, family 2, subfamily d, polypeptide 3; cytochrome P450, family 2, subfamily d, polypeptide 4; cytochrome P450, family 2, subfamily d, polypeptide 6; cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2; cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2; cytochrome P450, subfamily 2D, polypeptide 6; cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising), polypeptide 7 pseudogene 2; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising), polypeptide 8 pseudogene 2; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing), polypeptide 6; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing)-like 1; cytochrome P450, subfamily IID, polypeptide 6; Cytochrome P450, subfamily IID3; Cytochrome P450, subfamily IID4; cytochrome P450-16-alpha; Cytochrome P450CB; Cytochrome P450-CMF3; cytochrome P450-DB1; Cytochrome P450-DB3; cytochrome P450-DB4; debrisoquine 4-hydroxylase; flavoprotein-linked monooxygenase; microsomal monooxygenase; nonfunctional cytochrome P450 2D6; P450 2D-29/2D-35; P450-2D; P450C2D; P450-CMF3; P450DB1; P450-DB1; P450-DB3; P450-DB4; testosterone 16-alpha hydroxylase; xenobiotic monooxygenase
Gene Symbols Cyp2d3, Cyp2d4, CYP2D6
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Cytochrome P450 2D6 (315-347aa AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1565, 171522, 24303
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.