CYP2U1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179914

Catalog No. NBP179914

Description

CYP2U1 Polyclonal specifically detects CYP2U1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CYP2U1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cytochrome P450 2U1, cytochrome P450, family 2, subfamily U, polypeptide 1, EC 1.14.14.1, P450TEC
• Host Species: Rabbit
• Molecular Weight of Antigen: 69 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Goat: 79%; Horse: 79%; Sheep: 79%; Mouse: 77%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Goat, Rabbit, Sheep
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_898898
• Gene Symbols: CYP2U1
• Immunogen: The immunogen for this antibody is CYP2U1. Peptide sequence VNICPWLYYLPFGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFID.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 113612
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.