CYP4F3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169678

Catalog No. NBP169678

Description

CYP4F3 Polyclonal specifically detects CYP4F3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CYP4F3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CYP4F, CYPIVF3, cytochrome P-450, Cytochrome P450 4F3, cytochrome P450, family 4, subfamily F, polypeptide 3, cytochrome P450, subfamily IVF, polypeptide 3 (leukotriene B4 omegahydroxylase), Cytochrome P450-LTB-omega, EC 1.14.13.30, leukotriene B4 omega hydroxylase, Leukotriene-B(4) 20-monooxygenase 2, leukotriene-B(4) omega-hydroxylase 2, leukotriene-B4 20-monooxygenase, LTB4HCPF3
• Host Species: Rabbit
• Molecular Weight of Antigen: 60 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 4051
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
• Gene Accession No.: Q08477
• Gene Symbols: CYP4F3
• Immunogen: Synthetic peptides corresponding to CYP4F3(cytochrome P450, family 4, subfamily F, polypeptide 3) The peptide sequence was selected from the N terminal of CYP4F3. Peptide sequence LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Canine: 86%; Rat: 85%; Mouse: 85%.
• Target Species: Human, Mouse, Rat, Canine
• Isotype: IgG

For Research Use Only