Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CYP4X1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CYP4X1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CYP4X1 Polyclonal specifically detects CYP4X1 in Human samples. It is validated for Western Blot.Specifications
CYP4X1 | |
Polyclonal | |
Rabbit | |
Human | |
CYPIVX1, cytochrome P450 4X1, cytochrome P450, family 4, subfamily X, polypeptide 1, EC 1.14.14.1, MGC40051 | |
CYP4X1 | |
IgG | |
59 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q8N118 | |
260293 | |
Synthetic peptides corresponding to CYP4X1(cytochrome P450, family 4, subfamily X, polypeptide 1) The peptide sequence was selected from the middle region of CYP4X1. Peptide sequence LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title