Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CYP8B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP168884
Description
CYP8B1 Polyclonal specifically detects CYP8B1 in Human samples. It is validated for Western Blot.Specifications
| CYP8B1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CP8B, CYP127 alpha-hydroxy-4-cholesten-3-one 12-alpha-hydroxylase, CYPVIIIB1, Cytochrome P450 8B1, cytochrome P450, family 8, subfamily B, polypeptide 1, cytochrome P450, subfamily VIIIB (sterol 12-alpha-hydroxylase), polypeptide 1,7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase, EC 1.14.13.95, FLJ17826,7-alpha-hydroxy-4-cholesten-3-one 12-alpha-hydroxylase, Sterol 12-alpha-hydroxylase | |
| Rabbit | |
| 58 kDa | |
| 100 μL | |
| Cancer, Cardiovascular Biology, Cellular Signaling, metabolism | |
| 1582 | |
| Human | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9UNU6 | |
| CYP8B1 | |
| Synthetic peptides corresponding to CYP8B1 (cytochrome P450, family 8, subfamily B, polypeptide 1) The peptide sequence was selected from the middle region of CYP8B1. Peptide sequence SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction